SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013259 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013259
Domain Number 1 Region: 380-767
Classification Level Classification E-value
Superfamily ALDH-like 2.52e-86
Family ALDH-like 0.00000014
Further Details:      
 
Domain Number 2 Region: 175-295
Classification Level Classification E-value
Superfamily Carbamate kinase-like 9.16e-21
Family PyrH-like 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013259
Domain Number - Region: 68-100
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.0489
Family PyrH-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013259   Gene: ENSDORG00000014100   Transcript: ENSDORT00000014100
Sequence length 792
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_377:56304:99831:-1 gene:ENSDORG00000014100 transcript:ENSDORT00000014100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQVCCSRFQPFSQRLLPWVQSTVSRSHRVQPPAATHVRSWSNIPFITVPLSRTHGKSF
AHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFTQYS
ICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVI
SVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPADQQSVTFGTKS
RVMGGAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXRAEIIHHLADLLTDQRDEILLANKKDLEEAQGRLATPLL
KRLSLSTSKLNSLAIGLRQIAASSHDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESR
PDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKDAVQLVNTREEVE
DLCRLDNMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMFVDSEASVDKVTRLVRD
SKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKS
LRTEYGDLELCIEVVDGVQEAIEHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVFWNA
STRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGNLKYL
HENLPVPQRNTN
Download sequence
Identical sequences ENSDORP00000013259 ENSDORP00000013259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]