SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013397 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013397
Domain Number 1 Region: 8-629
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 4.32e-196
Family Aconitase iron-sulfur domain 0.00000000000000365
Further Details:      
 
Domain Number 2 Region: 633-887
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 2.94e-83
Family LeuD-like 0.000000000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013397   Gene: ENSDORG00000014246   Transcript: ENSDORT00000014246
Sequence length 889
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2335:20617:51109:1 gene:ENSDORG00000014246 transcript:ENSDORT00000014246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNPFVHLVESLDPAQPEKKFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFLVKKNDV
ENILNWNVMQHKNIEVPFNPARVILQDFTGVPAVDDFAAMXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXTDSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLP
QVIGYRLAGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDEVSIKYLVQTGRDENKVKYIKKYLQAVGMFRDFCDSSQDPDFAQVVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVSPEHHHAQQTFVYNNS
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTSLSPGSGVVTY
YLRESGVMPYLSQLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNTKGQQVFLKDIWPTRDEIQAVE
RQFVIPGMFKEVYQKIETVNESWNSLEAPSEKLYFWNPKSTYIKSPPFFENLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTKRGLTPREFNSYGSRRGNDAIMA
RGTFANIRLLNKFLNKQAPQTIHLPSGETLDVFDAAERYQQAGLPLIVLAGKEYGAGSSR
DWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIP
DSLKPRMRVQVKLDTGKTFQVIMRFDTDVELTYFHNGGILNYMIRKMAK
Download sequence
Identical sequences ENSDORP00000013397 ENSDORP00000013397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]