SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013411 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013411
Domain Number 1 Region: 314-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000241
Family EGF-type module 0.008
Further Details:      
 
Domain Number 2 Region: 565-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000983
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 3 Region: 278-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 718-755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000343
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 5 Region: 352-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000411
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 6 Region: 682-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000571
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 464-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000572
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 8 Region: 236-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013411
Domain Number - Region: 532-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000976
Family EGF-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013411   Gene: ENSDORG00000014258   Transcript: ENSDORT00000014260
Sequence length 1167
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6018:5796:37149:-1 gene:ENSDORG00000014258 transcript:ENSDORT00000014260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYVRVCLKEYQPKVTPTCSYGHGATPVLGGNSFYLPPAGAAGDRARARPRAGGPRDPGLV
VIPFQFAWPRSFTLIVEAWDWDNDTTPDEDLLIERVSHAGMINPEDRWKSLHFSGHVAHL
ELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCN
LLHGGCSVPGERCSYGWQGKFCDECVPYPGCLHGSCVEPWHCDCETNWGGLLCDKDLNYC
GSHHPCVNGGTCINAEPDQYHCACPDGYSGKNCERAEHACASNPCANGGSCHEVPSGFEC
HCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKP
CLNALSCKNLIGGYYCDCLPGWKGVDCHININDCHGQCRHGGTCKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNVDFCEPSPCLNGAHC
YSLDGDYYCACPEDFGGKNCSWPREPCPGGACRVVDGCGVEVGPGVSGVAPTGVCGPHGH
CVSQPGGNFSCVCDSGFTGTYCHENIDDCLGQPCHNGGTCIDEVDSFRCFCPSGWEGELC
DTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXKNSSCLPNPCENGGTCVGSGDSFSCICRDGWEGRTCTHNTN
DCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRIXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAVARDRLLLLLCAQTSSGASAVEVAVSFS
PARDLPDSSLIQSAAHAIVAAITQRGNSSLLLAVTEVKVETVVMDGSSTGLLVPMLCSVF
SVLWLTCVVICVWWTRKRRKERERSRLPRDEGTNNQWAPLNPIRNPIERPGGHKDVLFQC
KNFTPPPRRAGEVLPGPGAHGGSGEDEDEELGREEEDSPEAEKFLSRKFTKDPSCPSGRS
ARWVASGPKVDNRAVRSTKDVQYTGKE
Download sequence
Identical sequences ENSDORP00000013411 ENSDORP00000013411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]