SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013638 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000013638
Domain Number - Region: 122-198
Classification Level Classification E-value
Superfamily UROD/MetE-like 0.068
Family Uroporphyrinogen decarboxylase, UROD 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013638   Gene: ENSDORG00000014503   Transcript: ENSDORT00000014502
Sequence length 227
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_545:375074:402462:-1 gene:ENSDORG00000014503 transcript:ENSDORT00000014502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGI
SKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTK
YFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNEEARKLIAELGSTSITNLGFRD
NWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Download sequence
Identical sequences A0A1S3FG63
ENSDORP00000013638 XP_012875486.1.60039 XP_012875487.1.60039 ENSDORP00000013638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]