SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013664 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013664
Domain Number 1 Region: 173-300
Classification Level Classification E-value
Superfamily TPR-like 5.51e-19
Family Tetratricopeptide repeat (TPR) 0.0035
Further Details:      
 
Domain Number 2 Region: 7-94,132-157
Classification Level Classification E-value
Superfamily FKBP-like 1.4e-16
Family FKBP immunophilin/proline isomerase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013664   Gene: ENSDORG00000014533   Transcript: ENSDORT00000014531
Sequence length 329
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_2393:39659:47249:-1 gene:ENSDORG00000014533 transcript:ENSDORT00000014531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIIARLREDGIQKRVIQEGRGELPNFQDGTKATFHYRTLHSDNEGCVLDDSQVRGKPM
ELIIGKKFKLPVWETIVCTMREGEIAQFLCDTKHVVLYPLVAKSLRNIAARKDPLEGQRH
CCGIAQMHEHNSLGHADLDALQQPQPLIFHIEMLKVESPGTYQQDPWAMTDEEKAKAVPL
IHQEGNRLYREGQVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDQQITPLLLNYCQCK
LVAEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPI
VGRELRALESRIRQKDEEDKARFRGIFSH
Download sequence
Identical sequences ENSDORP00000013664 ENSDORP00000013664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]