SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013840 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013840
Domain Number 1 Region: 440-641
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-56
Family Eukaryotic proteases 0.00021
Further Details:      
 
Domain Number 2 Region: 99-148
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-17
Family Fibronectin type II module 0.0019
Further Details:      
 
Domain Number 3 Region: 240-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000149
Family EGF-type module 0.028
Further Details:      
 
Domain Number 4 Region: 160-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000551
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 5 Region: 264-336
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000121
Family Kringle modules 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013840   Gene: ENSDORG00000014709   Transcript: ENSDORT00000014710
Sequence length 651
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4403:23986:30224:1 gene:ENSDORG00000014709 transcript:ENSDORT00000014710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPAWVPKPCSLTSPGPCAILLLLLLLRGPPASGNHTDPQGLNATDIPGIYTVPATSVT
PEATATGAPKAVTQGSQTGGLSPLPKAAPSGLSPQGPVLTEAGQPCRFPFRYGGRVLHSC
TSEGRARRKWCATTHNYDRDRAWGYCVEAALPAEGPAVPDPCASGPCLNGGTCSNTQDPV
SYHCACPPAFTGKDCGTEKCFDETRHEYLEPAERWARVQGARVEQCTCWEGRARCEHARH
TECPSHPCLNGGTCHLIVGTGTSVCACPPGYAGRLCNIVPGHCFLGNGTQYRGVAVTVVS
GLGCLSCNSELLYQYLHVDSVGAAALLGLGPHAYCRXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXMLSAEHLSNSPPRDSVSVVLGQHFFNQTTDVTQTFGIEKYVP
YSLYSVFNPSNHDLVLIRLKKKGDRCAVRSQFVQPICLPEAGSSFPAGQKCQIAGWGHVD
EHVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLAC
EKSGVVYLYGIISWGDGCGRRNKPGVYTRVASYVDWINDRIRPSKRPAAPP
Download sequence
Identical sequences ENSDORP00000013840 ENSDORP00000013840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]