SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013844 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013844
Domain Number 1 Region: 467-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.08e-76
Family Protein kinases, catalytic subunit 0.0000003
Further Details:      
 
Domain Number 2 Region: 311-394
Classification Level Classification E-value
Superfamily Kringle-like 1.33e-33
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 62-154
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-22
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013844
Domain Number - Region: 170-257
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0732
Family Frizzled cysteine-rich domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013844   Gene: ENSDORG00000014715   Transcript: ENSDORT00000014714
Sequence length 937
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6057:7277:200050:1 gene:ENSDORG00000014715 transcript:ENSDORT00000014714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRTRCRGTRPPPPPPPAALLLAARGAAAQETEFSVTAELAPTSSWNISSELDKDSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRISFRATSYGSRLRIRN
LDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS
IPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHMHTFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPECDSKDSKEKNKMEILYILVPSVAIPLAIAF
LFFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELG
ECTFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLG
AVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIA
AGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMP
PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR
MYSLMTECWNEIPSRRPRFKDIHIRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN
LSNPRFPNYMFPSQGIPPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPAG
PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGIT
VFGNKSQKPYKVDSKQPSLLGDSNIHGHTESMISAEL
Download sequence
Identical sequences ENSDORP00000013844 ENSDORP00000013844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]