SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013910 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013910
Domain Number 1 Region: 473-1001
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-145
Family alpha-mannosidase, C-terminal domain 0.00000000000664
Further Details:      
 
Domain Number 2 Region: 146-340
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.3e-58
Family alpha-mannosidase 0.0000000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013910   Gene: ENSDORG00000014786   Transcript: ENSDORT00000014786
Sequence length 1007
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6803:45678:101790:-1 gene:ENSDORG00000014786 transcript:ENSDORT00000014786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVGSPAPAFRMAAGGCPSAAGPWPDFRARRPPLCFLFVLLLAAPGARAAGYQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLED
TFGSDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKQVRKGKLEEQLWXXX
XXXXXXXXXXXXXVLPNGYNPPKNLCWDVLCADAPVVEDPQSPEYNADKLVQYFLKLAKT
QGQYYRTKHTVMTMGSDFQYEKANLWFENLDKLIRLVNEQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGWGPCEVLMSNALSR
LSGFKEVFSFCRSLNVSVCPLSQSASRFQVIIYNPLGRTVDHMVRLPVSEGALAVNDPDG
KTVPSAMVVLPGFYHQEEHSELLFAARVPALGFSIYSVARVSSQRPKARTKLSDPISQGQ
VLVIKNEYIRATFNPDTGLLMKIENIDQKLWLPVDQGFFWYNASKGNKESKQASGAYIFR
PSQKRPMPVSRWARTRVVKTALVQEVHQNFSAWCSQVIRLYLRQRHLELEWTVGPIPHGD
GWGKEVISRFDTRLNTKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNSRIY
ITDGVTQLTVLTDRSQGGSSLQDGSLELMVHRRLLEDDSRGVGEPLLELGSGQVVRGRHL
VLLDRVGRAAAGHRLLAEEVVLAPQIVLSSGHGTTYHPEAIPQTQYSGLRRELPPSVHLL
TLARWGPETVLLRLEHQFAKGEDSCRNLSAPVTLDLQNLFSAFTIIHLQETTLAANQPRA
SASRLKWTADTGPIAHPAPPVLDPASVTLQPMEIRTFLAQVQWQRDS
Download sequence
Identical sequences ENSDORP00000013910 ENSDORP00000013910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]