SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013956 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013956
Domain Number 1 Region: 608-908
Classification Level Classification E-value
Superfamily ALDH-like 5.5e-104
Family ALDH-like 0.0000000627
Further Details:      
 
Domain Number 2 Region: 8-208
Classification Level Classification E-value
Superfamily Formyltransferase 6.54e-52
Family Formyltransferase 0.00000000277
Further Details:      
 
Domain Number 3 Region: 422-573
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-33
Family ALDH-like 0.0000345
Further Details:      
 
Domain Number 4 Region: 212-313
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.35e-25
Family Post formyltransferase domain 0.0000017
Further Details:      
 
Domain Number 5 Region: 332-417
Classification Level Classification E-value
Superfamily ACP-like 0.0000032
Family Acyl-carrier protein (ACP) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013956   Gene: ENSDORG00000014835   Transcript: ENSDORT00000014835
Sequence length 909
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3626:106369:141108:-1 gene:ENSDORG00000014835 transcript:ENSDORT00000014835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFIPSTAMKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTIPDKDGKADPLGLEAEKDGVPV
FKFPRWRARGQALPDVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRH
RGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGV
KGMVQAVRLIAEGKAPRFPQPEEGATYEGIQKKETAKIDWAQPAEAIHNWIRGNDKVPGA
WTEACGQKLTFFNSTLNTAGLVPDGEALPIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQ
LEDGGMIPASHFFKGAASSALELTEAELLTAEAVRSAWKRILSNVPEIEDTTDFFKSGAA
SVDVVRLVEEVKELCDGLELENEDVYMATTFGAFIQLLVRKLRGEDEESECVIDYVECAV
NKLTLQMPHQLFIGGTFVDAEGNKTYDTINPTDGSVICQVSLAQASDVDKAVAAAKEAFE
NGLWGKINARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYF
AGWCDKIQGSTIPINQARPNRNLTLTRKEPIGXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVTPLTALKFAELTLKAGIPKGVINILPGSGSPTGQRLLDHPDVRKIGFTGSTE
VGKHIMKSCALSNVKKVSLELGGKSPLIIFADCDLGKAVQMGMSSVFFNKGENCIAAGRL
FVEDSIHDEFVRKVVEEVGKMKIGNPLDRDTNHGPQNHQAHLRKLVEYCQRGVEEGATLV
CGGKQLPRPGFFFEPTVFTDVGDHMFIAKEESFGPIMIISRFADGDMDTVLSRANATEFG
LASGVFTRDINKALYVSDRLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYL
RIKTVTIEY
Download sequence
Identical sequences ENSDORP00000013956 ENSDORP00000013956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]