SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013974 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013974
Domain Number 1 Region: 3870-4063
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-36
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 4265-4441
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-32
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 3 Region: 3511-3678
Classification Level Classification E-value
Superfamily Fibronectin type III 1.3e-31
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 4527-4732
Classification Level Classification E-value
Superfamily Fibronectin type III 6.95e-31
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 5 Region: 4731-4925
Classification Level Classification E-value
Superfamily Fibronectin type III 1e-30
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 6 Region: 2140-2327
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-28
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 7 Region: 2529-2672
Classification Level Classification E-value
Superfamily Fibronectin type III 2.65e-28
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 8 Region: 3685-3864
Classification Level Classification E-value
Superfamily Fibronectin type III 1.95e-27
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 9 Region: 4076-4260
Classification Level Classification E-value
Superfamily Fibronectin type III 3.18e-27
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 10 Region: 1517-1658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-26
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 11 Region: 2336-2531
Classification Level Classification E-value
Superfamily Fibronectin type III 8.83e-25
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 12 Region: 1052-1243
Classification Level Classification E-value
Superfamily Fibronectin type III 9.74e-23
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 13 Region: 2923-3084
Classification Level Classification E-value
Superfamily Fibronectin type III 5.41e-22
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 14 Region: 1903-2055
Classification Level Classification E-value
Superfamily Fibronectin type III 7.05e-22
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 15 Region: 2776-2923
Classification Level Classification E-value
Superfamily Fibronectin type III 7.38e-22
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 16 Region: 2011-2136
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-21
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 17 Region: 2688-2796
Classification Level Classification E-value
Superfamily Fibronectin type III 4.55e-21
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 18 Region: 1424-1505
Classification Level Classification E-value
Superfamily Fibronectin type III 8.21e-16
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 19 Region: 119-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000297
Family Pentraxin (pentaxin) 0.038
Further Details:      
 
Domain Number 20 Region: 4435-4538
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000118
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 21 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 22 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 23 Region: 641-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0053
Further Details:      
 
Domain Number 24 Region: 747-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 25 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 26 Region: 1001-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000257
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 27 Region: 575-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 28 Region: 1725-1771
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000146
Family Laminin G-like module 0.032
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013974
Domain Number - Region: 518-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000138
Family Laminin-type module 0.039
Further Details:      
 
Domain Number - Region: 950-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000446
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013974   Gene: ENSDORG00000014848   Transcript: ENSDORT00000014853
Sequence length 5164
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3077:57530:669608:-1 gene:ENSDORG00000014848 transcript:ENSDORT00000014853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCLAPLLGSGSLFRVIAALILACFASVSLASSRGLFPRLVNLGAFKNVSIVPTQAVCGL
AGQSAFCHSSELAPGNQPCTQRFCIQDCPYRSSSPPYTALFSTGLGNCTTADRDDLHPGS
PSNSTSFRFGNHKNCFSSLPSLRLASALTLAVWLKPEEEGVMCVIEKTAEGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHVSVQVHQTKISFFFNGLEEDSKAYDVR
TLRGPVEDFASSTVQIGQSSNGLQKFVGRMQDFRFYKVVLTNREILEVFSGELPRLHTQP
HCRCPGSHPRVQPLAQKYCVPNGAEDTTENRVSRLHPEAHPLAFVNDDDIATSWVSHVFT
NITHLNQGVTISLDLENGQYQVFYIIVQFLSPQPTAIRIQRKKEDRSDWEDWQYFARNCS
TFGMKNNGDLEHPDSVICLQLPNLTPFSHGNFTFSILRPGLKPRPGYNNFCNTPSLQEFV
KATQVRLHFHGQYYTTETEFNVGHRYYAVNEITIIGRCQCNGHANNCDTTSQPYQCLCSQ
ESFTEGFQCDRCLPLYNDKPFRRGNKAQAFPCRPCLCHGHARSCHYDASVDPFPSEHEKG
GGGVCDDCQDNTSGKNCELCKDYFYRESGADLSARDVCKSCNCDKTGTRHGSLLCEKIGG
QCNCKRHVSGRECNQCQNGFYNLQELDPDGCSSCNCNASGTVDGDITCHPNSGQCKCKAN
VIGIRCDRCNFGFKFLRSFRGDGCESCQCNLHGSVNKFCNPLSGQCECRKEVTGLQCDTC
RENFYGLDVTGCKACNCNAAGSLSGTVCDAETGQCLCKPNVGGRQCDQCLAGYFYLQQKN
SFLCLPCHCDKTGTANASLPCDRSTGQCPCKSGVTGLHCNQCEPHRYNLTMVNLHTCQMC
ECDSLGTFPGTICDPVSSQCLCAPNRQNRCHQCPAGFYVSPSNASVCVPCSCHIPGAVSH
ICDSLTGQCTCQDISTGGQNCDQCDDKYFGFDPQTGRCQPCNCHLSGALNATCHLVTGQC
SCKQFVTGSKCDTCVPDASHLDVKNPLGCSKTPSQQPPPRGEIQSSSAISLSWNPPDSPN
AYXXXXXXXXXXXXXXXXXXXXXXXXIQYFKDTFLSPYTSYSYDIKTTSVHGSTRSMAVI
YQTKAGVPEGHLNLTYIIPVSSNFVTFTWSALSNRSGPIEKYILSCVPLDSVPPCVPYEG
QETSATIWNLVAFSQYNFSVQACTSGGCLHSLPITVTTAQAPPRKLSPPQIQKTSSTEVH
AEWAPPMDPNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLHTAKPQDLSYVVNGLKPYTIY
GFTVSLCNVVGCVISASGTGQTLAAAPAQLRPPVVKGINSTTIHLMWLPPEEVNGPPPLY
QLERRESALPASMAAMTKGIRFMGNGYCKFPSTTHPLGTDFTGIKASFRTRASDGLIVFA
ASPGNQEEYFALQLKNGRPYFLFDPQGSSVAVTTTNDHGKHYNDGKWHEIIAIRHQAFGQ
ITVDGQYIGSSTSVNGSTIIGDNTGVFVGGLPPDYTILRKDLXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLELPSNTFRGGTEFEI
SLKFRTDQLNGLLLFIYNKDGPDYMAMELRGVLSFQLNAFTLTQVXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGGC
MKDVTFTRGTVVNLASVSSSAVTVNLDGCLSTDITRNCRGNDFILVYQGGAQSAYEHRLQ
PFTEYLYRVIASHEGGSVFSDWSRGRTIGTAPQSVPTPSRARSINGYKLEVTWDEPIVVN
GVLEKYILKAYSEGDHHSSWMPSAQAEFISTTPLTGILTGLLPFRNYAVTLTACTLAGCT
ESSQALNISTPQEAPQEVQPPVAKSLLSLLLSWNPPKQANGIITQYSLYMDGNLIYSGCM
ENYTVTDLRVFMPHQFLLSACTHVGCTNSSRVILYTAQLPPEQVDPPILTVLGSRTVHVQ
WKQPQKLNGILERYLLYISNHTGDFTVWNVIYNSTELSQQHVLPYLFPGNKYLIKLGACT
GGGCTLSEASEAHTDEESPAGVPAPKVHSYAPDSFNISWTEPDSPNGVITRYGLYLDGVL
IHNSSELSCHADGFAPGSFHSFQVLACTARGCALGPLVENHTQEAPPEGKVTVFVETERS
QKPRLRWEPPFHPNGRLTYSVLFTGIFYADRAGNNYTLVRGTKIMHSTKETNVWVLTDEL
VPFTNYTIQVNASNSQGSLTSDPTTLAMPPGAPDGLLPPRLSSATPTSLQVVWSTPARNN
APGSPRYQLQMRPGYSTHGFRELFPHPSASLNYEVRDLQPYTEYEFRLVASNGFGSVHSS
WIPFMTAEDKPGPIYPPVLQDVKSRMMSVTWQRPLESNGIITHYNLYLHGQLYLRTSGNV
TNCTAIHLSPDTAYKFQVEVCTSKGCSLSPESRTVRTLPGAPEGIPSPELFSDTPTSVII
SWQPPTHPNGLVDNITIERRVKGKEEVTDLVTLPRSHPMRFIDKTPILSPWTKYEYRVLM
STVNGGTNSSAWVEVTTRPSRPAGMQPPMVHVLGSDAAKVTWEPPLLQNGDILSYEIRMP
DPHLTITNVTSLGLSRVIDGLIPFTNYSVTIVACSGGNGYLGGCTESLPTCVTTHPALPQ
QVSPLSVIPLSESYVAISWQPPSRPNGPNLRYELLRRKIQQPLAANPPEDLNLWCNIYSG
TRWFYEDKGLSRFTTYEYKLFVHNSVGFTPSPEATVTTLAGFPERGPNLTASVLNHTAIG
VNWTKPSFQDLQGDVEYYTLFWSSASSNESLKMPPDLNAYIIGHLNPNTEYEIFISLFNG
MYSINSTVLHATTGQGEPQGMSPPEAVIINSTAVRVIWTSPSNPNGVVTEYSVYVNNKLY
RTGMDVPGSFILRGLSPFTVYDIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVCCNGILYDSRPGYHCCEEKYIPFVLNSTGICCGGRIREVQPNHQCCFGYYV
KILPGEVCCPDEEHHRVSIGIGDSCCGRMPYSSSGNQICCAGRLHDGHGQQCCGGQIVRQ
DLECCGGQEEGVVYSPLTGMFCCGQDYVNMSDTICCSASSGESKAHVKKNDPVPVKCCET
ELIPKSQRCCNGVGYHPLKYVCSDKISTGMMMKETEECGILCPVSMKATAFCGQCDFNST
SHVCAVTRGPRSSPGKTSSEELCSSAEETVHSGGVDTYSFTXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXKMGDEDAVLNWRNPIHPNGPIIYYSLLRNGMER
FRGTSLSFSDTKGIQPFQEYSYQLKACTVAGCTSSSKVVAGTTQGIPERVMPPSITASSA
ETLHLSWRVPVRPNGVIKEYQLRQAGRGLIYTDATDRRQHTVTGLQPYTNYSFTLTACTS
AGCASSEPFLGQTLQAAPEGVWVTPRHIIINSTAVELYWSPPEKPNGLISQYQLSRNGSV
LFLGGREEQMFTDTNLEPNSRYMYKLEAKTGGGSSSSDEYIVQMPTWTPEEIPPPYNITV
LGPYSIFVAWTLPGHRIPQIPLEYNVLLDNGSVTPLTFSVGHSQSTLLENLTPFTRYQLR
IQACQHGGCGVSSKMSVTTLEAAPEDLPTPVLRVLGSSCIEVKWVPPTKPNGVIIKYFLH
RRPAGMEEESLLFVWSEGALEFMDDSETLRPFTLYQYRIRAQNSRGSVDSLWSSAQTLEA
PPQILPAPRAQVTSAHSVLLNWVKPEAPNGIISHYRVVYQERPDDPMFNGSTMHAFTVMG
TRHEAHLYGLEPFTTYHIGVVAVNRAGNVSSPWTLIRTSESSPSGLSKFTVEQKENGRAL
LLQWSEPVRTNGVLKMYNIFSDGLLDYTGLNRQFLFRRLDPFTLYTLTLEACTEAGCTHS
APQPLRTQEAPPDSQLAPTVQTVESTSVELHWSEPINPNGKIIRYAVIRRCFERKAGGKQ
TIQADEKIVFSEFHTERKTFTYHDTDLQPWTQCEYKICTWNSAGNTCSSWSMVRTLAAPP
ERLSPPEVSYVSMNPPELLISWGPPEHPNGIIQSYKLRRNGTLYPFSFDAVTFSYTDHEL
LPFSTYSYAILGCTSGGCTASIPTHITTPEAAPSGVSPPTLRTINANQINVSWSPPSRPN
GRITKYLLGCNGEEYLGGQNLSLLLPHLQPYTQYNVSLTACTNGGCTTSVSKSARTTEAP
PENMDPPTLQVTGSVSIEITWKPPRNPNGQMRSYELRRDGTIVYTGLETRYHDFTLTPGV
EYGYTVAAINSQGSILSPLVKERTSPSAPSGIEPPKLHATGPQEIVVTWDPPVRTSSDIL
NYTLFVRELFDRETKTTHFNTTHSSFGTRSFLVKQLKPFHRYEVRIQACASLGCASSDWT
STQTLETAPLMQPAPHLEVPRDGERFQPTVSLWWTEPLQPNGKVVYFQLYRRQKATRPEN
SSPVLIYNGSSSSFTDSELLPFTEYEYQVWSVNSAGKAWSNWTWCRTGPAPPEGLRTPTF
HAISSTQAVVNISIPAKPNGNVSLYRLFSNASGSQTVLSEGLATQQTLYNLQPFTTYFIG
VEACTCFNCCSKGPTAELRTHPAPPAGLPSPQVQMLTSRTASIQWGNPLLANGVIQRYEL
QLYVACPPDSALPCTSTQAETKYTGPGHRANLNELQPYTTYKLRVLAHNEVGSTASEWIS
FTTGKERTFIFQVTCTTDVGTVKTPLIQYNTATGTGLVLTTPGEKKGSRGKSTEFYSELW
FIILMAMLCLILLAIFLSLLLQRKIHREPYVRERPPLVPLQKRMSSLRGYPPGETHMFDS
VADISDVSSNVTLKSYTMHFEGLADAKIPRTGTPGSIRSSQSMSVLRIPSQSQLSQSYSQ
SSLHRSVSQLMDIQDKKVLTDESLWETIMGHSRGLYVDEEDLMNAIKGFSSVTKERTTFT
DTHL
Download sequence
Identical sequences ENSDORP00000013974 ENSDORP00000013974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]