SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013998 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013998
Domain Number 1 Region: 319-375
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000000000019
Family VPS37 C-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 56-124
Classification Level Classification E-value
Superfamily UBC-like 0.00000000407
Family UBC-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013998   Gene: ENSDORG00000014879   Transcript: ENSDORT00000014879
Sequence length 391
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4206:179207:206043:1 gene:ENSDORG00000014879 transcript:ENSDORT00000014879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKSASSSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNNLTININ
ILLPPQFPQEKPVISVYPPIRHHLMDKQGIYVTSPLVSNFTMHSDLGKIIQSLLDEFWKN
PPVLAPTSTAFPYLYSNPSGLPPYASQGFPFLPAYPPQEANRNITSLSVADTVSSSTTSY
TTAKPAAPTFAVLSSLPLPVPTMETSTPISQNGFGYKMPDVPDAFPELSELSVSQLTDMN
EQEEVLLEQFLSLPQLKQIINDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQ
MKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEIDDFLSSF
MEKRTICHCRRAKEEKLQQVIAMHSQFHAPL
Download sequence
Identical sequences ENSDORP00000013998 ENSDORP00000013998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]