SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014011 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014011
Domain Number 1 Region: 295-380
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.09e-20
Family HSP40/DnaJ peptide-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 179-255
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 2.88e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.00032
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014011
Domain Number - Region: 163-200,259-290
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000314
Family HSP40/DnaJ peptide-binding domain 0.015
Further Details:      
 
Domain Number - Region: 99-152
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00178
Family Chaperone J-domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014011   Gene: ENSDORG00000014892   Transcript: ENSDORT00000014892
Sequence length 436
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2489:105718:120461:1 gene:ENSDORG00000014892 transcript:ENSDORT00000014892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVAAFAHSLSARGPPALLTLRPVSITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLSDEVKRKQYDAYGSAGFDP
GASSSGQSYWRGGPSVDPEELFRKIFGEFSSSSFGDFQSVFDQPQEYIMELTFNQAAKGV
NKEFTVNIMDTCERCDGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSI
ITNPCVICRGTGQAKQKKRVVIPVPAGVEDGQTVRMPVGKREIFVTFRVQKSPIFQRDGA
DIHSDLFISIAQAILGGTARAQGLYETINVTIPPGIQTDQKIRLTGKGIPRINSYGYGDH
YIHVKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTHTSTGGRTMDSSEGNNARREAG
EDKEGFLSKLKKIFIS
Download sequence
Identical sequences ENSDORP00000014011 ENSDORP00000014011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]