SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014270 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014270
Domain Number 1 Region: 144-246
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.35e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014270   Gene: ENSDORG00000015158   Transcript: ENSDORT00000015159
Sequence length 1057
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_291:200:38834:1 gene:ENSDORG00000015158 transcript:ENSDORT00000015159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSFAAVFSFLSGRLVHISEQAALILNCKKDFLESSHFVDLLAPQDVKVFYTHTARAQLPV
WNSWTRGAASQYEYTPVKPFFCRIRGGRDKVQEKHYSPFRILPYLVHVHSSAQPESEPCC
LTLIEKTHSGYEAPRIPVGKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYL
HPEDRPLMFAMHQKVLKYVGHPPFEHSPVRFRTQNGDYIILDSSWSSFVNPWSRKVSFII
GRHKVRTSPLNEDVFATRIKQTNSSDKDITELQEQIHKLLLKPVHASASSGYGSLGSSGS
QEQLVSITSSSESSGHWAEDMPKEPMTLEQVYANVNEIKNLGQQLYIESKTKSSSVKPGM
RMRTELQGGEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLK
SYSIPTLKRKCISCTNTTSSSSEEDRQSHKADSGQTPQAAAQNTARPTVEMPATGGGAWT
MSMAALSVGSAVSPCRSSSIACALPLHPAEDATMVCEPWALEARPVPLTAEEMRHVGLTA
AVLSAHTQKEEQNYVDSFREKILASPYSCYLQQESRSKAKYSYVQGASPSKQSRSTWSKK
GQHKRQRLPVPLDASSCGPGLCPHAGALLPGVQPWGPPTAASPSASGLPSPSTLLVPSQA
PYLLPVCPLLALTSVGGAATAWAAAPGCPLASSRQAPPAPPPPHVDTRMTIVLPSPAVCS
LWPPPSSPYLFLGDPGSPEVPTPIPAPNLEPPTYASNQRRAEEKWETQSGEHLLLGSRSS
SPLQLNLLQEEMPASSESARPAGRGACPEPRRXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXSSGSSMSFISSDYSLEISRNGQQSQGVQEKALPRPAAE
SIWRMIEQTPERVLMTYQMPERVKDAVLKEDLERLESMRRHQPHFSPGQKEELAKVHSWI
QSQNIPPGVTPSRVACANRSSAEHSRARGLYPGEDIS
Download sequence
Identical sequences ENSDORP00000014270 ENSDORP00000014270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]