SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014276 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014276
Domain Number 1 Region: 25-233
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8e-37
Family Eukaryotic proteases 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014276   Gene: ENSDORG00000015166   Transcript: ENSDORT00000015166
Sequence length 236
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6719:70177:75291:-1 gene:ENSDORG00000015166 transcript:ENSDORT00000015166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVIFYLTILAGTSFVTQSAVQKEDPAPYLVYLKSHFNPCVGVLIKTSWVLAPAHCYLPN
LKVMLGNFKSRIRDGTEQTISPIQIIRYWNSSHSAPQDDLMLIRLANPAVLNHKVQTIPI
ASSDVQPGTVCMLSGIDWSQENSGRHPDLRQNLEAPVMTDAECQKTEQGRTHRNSLCIKF
VKVFSRILGEVAVATVICNNQLQGIEVGHFMGGDVGIYTNVHRYISWIENTTKDKG
Download sequence
Identical sequences ENSDORP00000014276 ENSDORP00000014276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]