SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014309 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000014309
Domain Number - Region: 365-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00135
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 752-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.008
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 539-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00904
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 799-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 713-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Laminin-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014309   Gene: ENSDORG00000015201   Transcript: ENSDORT00000015202
Sequence length 1138
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3695:67510:163987:1 gene:ENSDORG00000015201 transcript:ENSDORT00000015202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMESCLGFICLLLCYWIGKASPLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSCTDI
LNWFKCTRHRISYRTAYRHGEKTMYRRKSQCCPGFYESRDMCVPHCADKCVHGHCIAPNT
CHCEPGWGGTNCSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCEDLCPPGKHGPQCEQRCPCQNG
GVCHHVTGECSCPSGWMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXCQDECPVGTYGVHCAETCRCVNGGKCYHVSGACLCEAGFAGELCEARLCPEGLYGIK
CDKRCPCHLDHTHSCHPMSGECACRPGWSGLYCNETCSPGFYGEACQQICSCQNGADCDS
RTGQCTCAPGFKGVDCSTPCPLGTYGINCSSRCGCKNNAVCSPVDGSCICKAGWHGVDCS
IRCPSGTWGFGCNLTCQCLHGGACDTLDGTCTCAPGWRGGKCELPCQDGTYGLNCAERCD
CSHADGCHPTTGHCRCLPGWSGMHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGICECA
PGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVCPSG
RFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHNGAF
CSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGFMGR
HCEQKCPAGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLNSLS
RTSTALPADSYQIGAIAGIIILVLVVIFLLALFVIYRQKQKGKDSSMPAVSYTPAMRVIN
ADYSMAETIPHGSVCGNGNSHYTNPSYHTLTQRAASPHFNNRETLTIAKAKNNQLFVNLK
SVNPGKRGPVVDCAGTLPADWKQGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSSNCSL
SSSENPYATIKDPPVLLPKTSECGYVEMKSPARRDSPYAEINNATSANKNVYEIEPTVSV
VQGIFSNNGHLTQDPYDLPKNSRIPCHYDLLPARGSSSSPKREDGGGGSSSSSSSSSE
Download sequence
Identical sequences ENSDORP00000014309 ENSDORP00000014309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]