SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014312 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014312
Domain Number 1 Region: 178-329
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000384
Family Growth factor receptor domain 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014312
Domain Number - Region: 144-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014312   Gene: ENSDORG00000015205   Transcript: ENSDORT00000015205
Sequence length 350
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3277:27116:35949:1 gene:ENSDORG00000015205 transcript:ENSDORT00000015205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPPRASLGLLLLLLLSPAAGTTRKPTPCQQCRNLVDKFLQGMATAKKNFGGGNTAWEE
KTLSKYEFSEVRLVEILEGLCESSDFECNQMLEEHEEQLEDWWLQLKNAHPDLFEWFCVR
TLKVCCAQGTYGPDCRACQGGAERPCSGNGHCRGDGTRHGDGSCQCHLGYKGPLCSDCTD
GYFSLLKNETHSVCKACHESCKTCSGPTSRDCHECEVGWLRIEGACTDLDECAAETPPCG
DAQYCENVSGSYTCEECDSTCVGCTGKGPANCKECVAGYTKESGQCTDIDECSLAEKACR
RKDENCYNTPGSFVCVCPEGFEETEDACVRTAEGEVTEEHPTEPPFREDL
Download sequence
Identical sequences ENSDORP00000014312 ENSDORP00000014312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]