SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014432 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014432
Domain Number 1 Region: 42-164
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000000000000432
Family PHP domain 0.064
Further Details:      
 
Domain Number 2 Region: 204-250
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000000275
Family RNase P subunit p30 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014432   Gene: ENSDORG00000015333   Transcript: ENSDORT00000015334
Sequence length 286
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3854:10036:36711:1 gene:ENSDORG00000015333 transcript:ENSDORT00000015334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFADLDLRAGADVKTLRGLVETAAHRECGRLRAALAPRRSRRALLCIGYSVVAINHIV
DFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRLTIIVTDPSHCNVLRATSSRVRL
YDIVAVFPKTEKLFHVACTHLDVDLVCITLTEKLPFYFKRPPINVXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXNVIISSAAERPLEIRGPYDVANLGLLFGLSENDAKA
AVSTNCRVALLHGETRKTAFGIISTVKKPRSSEGDDDSFPVCKKAK
Download sequence
Identical sequences ENSDORP00000014432 ENSDORP00000014432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]