SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014473 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014473
Domain Number 1 Region: 358-486
Classification Level Classification E-value
Superfamily Plus3-like 7.32e-29
Family Plus3 0.00000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014473   Gene: ENSDORG00000015379   Transcript: ENSDORT00000015379
Sequence length 638
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3155:6967:34461:1 gene:ENSDORG00000015379 transcript:ENSDORT00000015379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRLCVGRAAAAAAAAAVAVPLAGGQEGSPGGVRRGSRGTTMVKKRKGRVVIDSDTEDS
GSDENLDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVSDSDSNSSFSSSDSDSSSEDEEF
HDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKE
KKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAE
LLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEE
LNRVRLSRHKLERWCHMPFFAKTVTGCFVWIGIGNHNSKPVYRXXXXXXXXXXXXXXXXX
XXXXXXXXXXXHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELS
IKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQ
LNELEERAEALDRQRTKNISAISYINQRNREWNIVESEKALVAESHNMKNQQMDFRRQCK
PTIVSNSRDPAVQAAILAQLNAKYGSGVLPDAPKEMSK
Download sequence
Identical sequences ENSDORP00000014473 ENSDORP00000014473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]