SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014474 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014474
Domain Number 1 Region: 35-218,299-459
Classification Level Classification E-value
Superfamily L domain-like 5.44e-58
Family Ngr ectodomain-like 0.00066
Further Details:      
 
Domain Number 2 Region: 1145-1334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.49e-44
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 513-670,813-867
Classification Level Classification E-value
Superfamily L domain-like 4.54e-29
Family Ngr ectodomain-like 0.00034
Further Details:      
 
Domain Number 4 Region: 1078-1116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000493
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 918-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000671
Family EGF-type module 0.005
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014474
Domain Number - Region: 1330-1370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000174
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1375-1409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1420-1450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000381
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014474   Gene: ENSDORG00000015380   Transcript: ENSDORT00000015380
Sequence length 1529
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4191:29258:134383:-1 gene:ENSDORG00000015380 transcript:ENSDORT00000015380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALMPRWGTLAGLIRPELWLLLLWAVAWRLGATACPALCTCTGTTVDCHGTGLQAIPKNI
PRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRN
QLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRA
LRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPSIGLF
TQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVATCTLSSGSCPAMCACSNGIVDCRGKG
LTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFHGLRSL
NSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQS
LAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLANKRIGQ
ISKKFRCSPKEQYFIPGTEDYHLNSECSSDVTCPHKCRCEASVVECSSLKLSKIPERVPQ
STAELRLNNNDISILEATGMFKKLTHLKKINLSNNKVSEIEDGTFEGASSVSELHLTANQ
LESIRSGMFRGLDGLRTLXXXXXXXXXXXXXXXXXXXXXXXXXXYDNHITTISPRGFDTL
ALSTLNLLANPFNCNCQLAWLGDWLRRRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCEE
GQEGSCLPRPQCPQECACLDTVVRCSLQALPRGIPXXXXXXYLDGNQFTLVPGQLSTFKY
LQLVXXXXXXXXXXXXXXXXXXXXXXXXILSYNALQCIPPLAFQGLRSLRLLSLHGNGIS
TLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKLLL
TTPAKKFECQGPPTLAVQAKCDPCLSSPCQNQGICHNDPLEVYRCTCPSGYKGRDCEVFL
DNCSNSPCGNGGTCHALEDEEAGFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCECAPGYTGDNCTENQD
DCRDHRCQNGAQCVDEVNSYSCLCAEGYRGQLCEIPPHTPAPSSPCEGAECQNGAHCVDQ
GNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDNGILLY
NGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVTFDQMVNLSIDGG
RPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQD
FTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPADGPCHGHK
CVHGKCVPLDALSYSCQCQDGYSGALCNQAGAAAEPCGGLQCLHGHCQASATKGAHCVCD
PGFSGELCEQESECRGDPVRDFHRVQRGYAICQTTRPLSWVECRGTCQGQGCCQGLRLKR
RKLTFQCSDGTSFAEDVEKPTKCGCALCV
Download sequence
Identical sequences ENSDORP00000014474 ENSDORP00000014474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]