SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014924 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014924
Domain Number 1 Region: 433-582
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.47e-53
Family Myeloperoxidase-like 0.0000000748
Further Details:      
 
Domain Number 2 Region: 74-168
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.35e-21
Family Myeloperoxidase-like 0.00000269
Further Details:      
 
Domain Number 3 Region: 33-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000645
Family EGF-type module 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014924   Gene: ENSDORG00000015866   Transcript: ENSDORT00000015864
Sequence length 600
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2170:234804:256443:1 gene:ENSDORG00000015866 transcript:ENSDORT00000015864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSSLPLRFPLLLLLLPAPPVLPVDPGTPTPVNPCCYYPCQNQGVCVRFGLDGYQCDCT
RTGYLGPNCTIPELWTWIRSSLRPSPTFVHFLLTHGQWFWEFVNATFIRDFLMRLVLTVR
SNLIPSPPTYNLAHDYISWESFSNVSYYTRVLPSVPKECPTPMGTKGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXIGGGRNIDHHVLHVAIDVIKEGREMRMQPFNEYRKRFGMKPYTSFQE
LTGEEEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEIGAPFSLKGLLGNPIC
SPEYWKPSTFGGEVGFNLVNTATLKKLVCLNTKTCPYVSFHVPYSSQDDEPAIERPSTEL
Download sequence
Identical sequences ENSDORP00000014924 ENSDORP00000014924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]