SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015117 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015117
Domain Number 1 Region: 495-718
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.32e-55
Family Eukaryotic proteases 0.0000000102
Further Details:      
 
Domain Number 2 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 1.18e-35
Family Kringle modules 0.00000722
Further Details:      
 
Domain Number 3 Region: 210-296
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-34
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 389-477
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-28
Family Kringle modules 0.00044
Further Details:      
 
Domain Number 5 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 6.28e-21
Family Hairpin loop containing domain 0.00000558
Further Details:      
 
Domain Number 6 Region: 301-347
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000266
Family Kringle modules 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015117   Gene: ENSDORG00000016073   Transcript: ENSDORT00000016073
Sequence length 726
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_152:32376:98476:-1 gene:ENSDORG00000016073 transcript:ENSDORT00000016073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPVLLLQPVLLHLLLLPTAIPSAAGQKKRRNTLHEFKKSAKTTLIKEDPLLRIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKGFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQHWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTINDTHVPM
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDVTPENFKCXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTQTNVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARD
LKDYEAWLGVHDVHGRGEEKRKQVLNISQLVYGPEGSDLVLLKLARAILDSFVSTIDLPN
YGCTIEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCNQHHQGKVTLSESELCAGAE
NIGSGPCEGDYGGPLVCEQHKMRMLLGVIVPGRGCAIPNRPGIFIRVAYYAKWMHKVILT
YKAQQS
Download sequence
Identical sequences ENSDORP00000015117 ENSDORP00000015117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]