SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015130 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015130
Domain Number 1 Region: 1402-1541
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.73e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000227
Further Details:      
 
Domain Number 2 Region: 182-285
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000742
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015130   Gene: ENSDORG00000016086   Transcript: ENSDORT00000016086
Sequence length 1546
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1518:63446:100072:-1 gene:ENSDORG00000016086 transcript:ENSDORT00000016086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NIPEDLRDPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQAATLQGHQSVIQAL
SRKGLYVIESDDTPVTDEDLGHAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFST
FSASKELPYDLEDAMVFWINKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREHPSARQ
SPYFPLLEDLMRDGSDGAALLAVVHYYCPEQMKLDDICLKEVPSMADSLYNIRLLREFSS
EHLNKCFYLTLEDMLYAPPVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKTVLQ
QKCSRPPVPISNATKRSFLGSPAVMSPADLPAPSQPVVEGGHRYLLHPEEPEYLGKGTSA
FSSSHPLLPLRQKQQKAAQAEDAPDQRHRSNSLTRVDGQPRGAAIAWPDKKNRPVSQPTP
FALHHATSCDVDPSSGDSISLARSISKDSLASNIIHLTPHNQPDPAAGKSDGRSLLSNVN
MDDEEEELVAIIRTDVSPQGGDPEAPRASPRTLGLMATARSPLRPADTLESKSDSFFLEP
LMPAVLRPAKEKQVTTKEDERGEGRPRGAPAKRAVEGTQPLVRKKAASSHGGRDLNRTFT
PIPCKLTASVDPAEEASRVSEATGEVHGGPVAAGGFDPFPQRQADGFLHVGRTDEDTEGR
LYVSSQSPSSHDSEPWTILRQDSDSDVVDVDDAEQEFLGEDRAVLLPRYTGEEESAKLQE
DMKVKEHEDKDDASGRSSPCLSTTSQLSSMSVASGSVKMTSFAERKLQRLNSSETKSSTS
SSQKTTPDASESCPAPLTTWRQKREQSPTRHNKDPASLLASELVQLHMQLEEKRRAIETQ
KKKMEALSARQRLKLGKAAFLHVVKKGKADGTPQPLRPEHKEYTQHNGEDVGDAVANAEG
FLKEEQREASEGPDVDRESLTFAQLHKPKDPSALPDVEMHRALSAALLEDSVEEEVVVDV
SEGDLSIEKLSETISTLQQAILKISQQQQQLLLKSPAVPVPGSKNHSQDQKVKAPVHFVE
PLSPTGATGHRKPPRLGQGRNSRSGRPAELKVPKDRQPASSRSKTPTPSVETLPHLRSCP
PSNHPRTPSDPGVDSVTDSGGNPSEKHLFDSYRLHDESNQRALVLPSSRDANVLSEQGTC
QEGLDASVKEAGLSVSAVLGKENVLVEEPLKSKASLIEVDLSDLKAPDEDGELTGHESSV
VLVGDGDQKPVVGFFFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXRKAEEDRIRKEEEKARRELIKQEYLRRKQQQILEEQGLGKPAKSKPKKPRPKSVHRE
ESCSDSGTKCPSTPDNLSQTHSGSSLSLASAATTEPESVHSGGAPSHRVESLEALPILSR
NPSRSTDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPH
KNSILEELEKCDANHYIILFRDAGCQFRALYCYYPDTEDIYKLTGTGPKSITKKMIDKLY
KYSSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKTQTRK
Download sequence
Identical sequences ENSDORP00000015130 ENSDORP00000015130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]