SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015224 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015224
Domain Number 1 Region: 104-238
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.61e-25
Family Glycosyl transferases group 1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015224   Gene: ENSDORG00000016183   Transcript: ENSDORT00000016183
Sequence length 243
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4003:5549:33703:1 gene:ENSDORG00000016183 transcript:ENSDORT00000016183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHLEAAGHVCILRDAFDFESPSDIADLITAENLDAALALHLYRGGRLLQGHHIPFGIIFG
GTDLNEDANQGLKNEVMGKVLEEARFAVAFTQSMKEKAQAQWVDPEFTREVKARVKRASG
VRLVGEMSQGDLHAAMKNCFALVNSSLSEGMSAAILEAMDLEVPVLARNIPGNAAVVEHE
VTGLLFSDPQEFIHLAKRLLHEPELERVLAARGKEYVRRHHAWQVERDTYQSLVRKLAGG
AED
Download sequence
Identical sequences ENSDORP00000015224 ENSDORP00000015224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]