SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015307 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000015307
Domain Number - Region: 143-234
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00226
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number - Region: 3-31
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015307   Gene: ENSDORG00000016269   Transcript: ENSDORT00000016270
Sequence length 331
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_12439:10011:35307:-1 gene:ENSDORG00000016269 transcript:ENSDORT00000016270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSDLCQGDPCGNASCVELNDKHFCKCPQGYYYTSLNCTKGTTFLSEITVKVPDTSGLDDE
HSLNYQALHDKINTFFSDALNNTDYKQTVIAQVSSRSARSLMRARSGEASVQNIFAEDTD
QTESTVSDLILQAAENDTDISVNNRMDPCESSGCKYDGNNCTDILLCECKTGLQRPNPFY
FALGLHCPDNCIAENKKQCTRDSNGASVCECLPGYKNDKGFCEKCPFGYNGKDCEDQFQL
ILTIVGTIAAFLILALVIALIVSVRSKNKGKNIEEQHLIDNDFQNLRLQQTGFSNAGAEG
NIFPQVRTSASRNTPEQNPYISQKSIPRPDY
Download sequence
Identical sequences ENSDORP00000015307 ENSDORP00000015307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]