SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015477 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015477
Domain Number 1 Region: 384-955
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.57e-131
Family alpha-mannosidase, C-terminal domain 0.0000418
Further Details:      
 
Domain Number 2 Region: 1-302
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.16e-87
Family alpha-mannosidase 0.0000238
Further Details:      
 
Domain Number 3 Region: 306-406
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.9e-26
Family alpha-mannosidase, domain 2 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015477   Gene: ENSDORG00000016448   Transcript: ENSDORT00000016450
Sequence length 957
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_121:777:23294:1 gene:ENSDORG00000016448 transcript:ENSDORT00000016450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESMRAYAANVYTSVVAELVRGQQRRFIAEEFFRLWWDHASEQQHQVHQLLKEGRLEFVLG
GQVMHDEAVTHLDDQILQLTEGHGFLYQTFGVRPQFSWHVDPFGASATTPTLFALAGFNV
HLISRIDYNLKDAMQKAQGLQFVWRGSRSLGAQQEIFTHVMDQYSYCTPSAIPFSNRTGF
YWNGVAFFPEPPPDGVYPNMSQPVTPDNIHLYAEVLVANVKQRAAWFRTPHVLWPWGCDK
QFFNASVQFANMDPLLDHINSRTAELGVSVQYATLSEFFHTLHTLNATWSVRDHHDFLPY
SSELWQAWTGFFTSRSTLKGLARRASALLYAGESMFTRYLWPAPHGALDPTWALQQLQQL
RWAVSEVQHHDAVTGTESPKVRDMYSEHLATGMLGVRKLMASLALEGLQQHAALQAPPGT
KPAGYSASVYNPLAWTVTTLVTLTVGFARVHVTDELGHPVPAQIQSSAGSSVYELLILAT
IPGLSYRHYQLRPATEPHAGPWEPAAAGAHVLRYGRRTRRQARQGGRKLVPVRNDCYTVL
LDRDTNLMDSIRESQSNRTVRVAQEFLEYHVNGDVKLGPISDNYLFTPKELAEPAWEAVE
MEIVAGKLATEIRQFFYRRASAQAYSYAIYSRLAHVPREADGQLLCHRIEQKYSAGPLEL
NREAILRTSTDLNSHQVLYSDNNGYQMQRRPYGRDNAIARNYYPMVQSAFIEDGRSRLVL
LSERAHGVSSQENGQVEVMLHRRLWNNLAWDLNYNLTLNDTSVVHPTLWLLLGPPALTTA
LRPRSGVELQHRPVVLLRELARASPEPQGLRQQTAVTLPPNLHLQVLSIPGWNYSTNHTE
HLRHLEQGHPGKAQADLHRVLLRLHHLYEMGEDPVLSQPVTLNLKAVLEGLGAVATVEER
SLTGTWDVHALRRWTWRTESAPRRGCPSSPPRPLPADTSITIHPKEIRTFFIHFQQQ
Download sequence
Identical sequences ENSDORP00000015477 ENSDORP00000015477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]