SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015608 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015608
Domain Number 1 Region: 2988-3165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-19
Family Laminin G-like module 0.039
Further Details:      
 
Domain Number 2 Region: 3417-3561
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.06e-17
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 2804-2990
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.64e-16
Family Laminin G-like module 0.024
Further Details:      
 
Domain Number 4 Region: 2609-2793
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000111
Family Laminin G-like module 0.026
Further Details:      
 
Domain Number 5 Region: 579-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number 6 Region: 1422-1473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 1332-1380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 1471-1519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 201-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 10 Region: 443-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000865
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 260-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 12 Region: 1750-1802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 13 Region: 396-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 14 Region: 489-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 15 Region: 534-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 16 Region: 1897-1941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 17 Region: 330-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 18 Region: 731-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000368
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 19 Region: 1944-1993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015608
Domain Number - Region: 1712-1752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family Laminin-type module 0.081
Further Details:      
 
Domain Number - Region: 695-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0187
Family Laminin-type module 0.027
Further Details:      
 
Domain Number - Region: 6-72
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0213
Family APC10-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015608   Gene: ENSDORG00000016589   Transcript: ENSDORT00000016591
Sequence length 3564
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2658:50127:96693:-1 gene:ENSDORG00000016589 transcript:ENSDORT00000016591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQYCDICTAANSNKAHPVSNAVDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLI
KFANSPRPDLWVLERSTDFGHTYQPWQFFASSKRDCLERFGPQTLERITRDDDVICTTEY
SRIVPLENGEIVVSLVNGRPGAMNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALR
DPTVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPSDPFRLQCACQHNTCGGSCDRCCPG
FNQQRWKPATTDSANECQPCNCHGHAHDCYYDPEVDRRNASQNQDSVYQGGGVCINCQHH
TTGINCERCLPGFYRAPDHPLDSPHACRRCSCELDFTDGTCEDLTGRCYCRPNYTGAQCH
KCAEGFTGFPHCYPVPTFSLNTTGEQVLPAGQIVNCDCSAAGTVGNACRKDPHLGRCVCK
PNFQGAHCELCRPGFYGPGCQPCQCSSPGVDSGICDPDSGQCQCRGGFEGAACNRCAPGY
FHFPLCQLCGCSPAGTLPGGCDEEGRCPCRPGFEGPHCDRCRPDHHGYPNCRACACDPRG
ALDQLCGAGGSCRCRPGYMGSACHECSPGFHGFPACVPCHCSAEGSLDTACDPQSGQCSC
RPRVTGLRCDACVPGTYDFPHCEAGPCHPAGQAPASPSLPEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSGHCFCKAHVCGQTCSACKDGFFGL
DQADYFGCHSCQCDVGGALGQGCEPKTGACRCRPNTQGLTCSEPAKNHYLPGLHHLRLEL
EEATTPTGHAVRFGFNPLEFENFSWRGYAHMSPIQPRIVARLNVTSPDLFRLVFRYVNRG
PTSVSGRVSMHEEAKLVACVNCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXHGVTLVPAEEFSTEFVEPRVHCVSSHGAFGLSRAACVPSRFPKPPQPIVLRDCQ
VLPLPPDLPLTRSQELAPGAAPPGPQPRPPTAVDPDIEPTLLRHPQTVVFTTQVPTLRYA
LLHGYQPHSTLVSLIMKGWQGHANASFCPHGYGCRTLVSCEGRTMLDVTDSELTVTVRVP
EGRWLWLDYVLVVPEDAYGPSYLREEPLDKSYDFISHCAAHGYHISPSSSTPFCRQAAAS
LSLFYNNGARPCGCHEVGATGPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPNCRPCDC
GARLCDELTGRCICPPRTVPPDCLVCQPRTFGCHPLVGCEECNCSGPGVQELTDPTCDTD
SGQCKCRPNVSGRRCDSCAPGFYGYPSCQPCDCHGAGTAPSVCDALTGQCHCKENVQGPR
CDQCRVGAFSLDASNPKGCTRCFCFGATERCRSSAHARREFTDMEGWTLLSSDRQVVPHE
HREGTWLYADLRHVVEAPELYWQAPPSYLGDRVSSYGGTLRYELHSETQRGDVFFPTESR
PGVVLQGNQMSITYLEPSYPAPGHVHHGRLQLVEGNFRHMETHNAVSREELMMVLASLEQ
LQIRALFLANSVSLRRVVLEVAGEMSMGPPASNVEVCMCPANYRGDSCQECAPGYFRDTK
GPFLGRCVPCQCHGHSDRCLPGSGICVGCQHNTEGDHCERCRAGFVSGGAGDPAAPCVSC
PCPLAAPSNNFAEGCVLRGGQAQCLCKPGXXXXXXXXGNSRTNDIIGYGEDNLVFSECEH
LSGANFDSRCHSSGYRCEAYAPGVYGIALLPGTCPRCDCSLCGTEACDPQTGRCVCKAGV
AGTRCDRCQEGHFGFELCQGCRPCACGPAAEGPQCHPQSGQCRCRPGTTGPQCRECAPGH
WGLPEHGCRRCQCPGGHCDPRTGRCTCPPGLGGDRCDVCSQQHQVPVPGGPGGHGIHCEV
CDHCVVLLLDDLERAGAILPAIREQLRSLNTSSAAWARLHRLNVSIADLKTQLRGPPDPR
HKTVQRLQTLERQSTSLVQDAQQLDSQAAGARDQAGRLLDSTEVTQGRAQTLLEKIRAVD
RALSELAAQMGHLTPANASAPSGETLSWTLAQVERLLREMRARSLGGPRAVAEAELAEAQ
TLLMHVQEHLAGRWGENQELSMEIHDQLAQYEADLMDLEEALNRAVDTTREAEELMXXXX
XXXXXXXXQRKQELSGDNATVVAALQAAQQTLNRVVELLHGVDVAKEELERLAASLDGAR
APLLQKMHLFSPAGSKLGLVEAAEAHARQLDQLALNLSSIIRGINQDRFIQRAVEASNAY
SSILQAVQAAERAAGQAQRQAAHTWELVVRKGLADRAQRLLANSSVLEVAIRGQRRRLDL
ARVALQGAGTQIRDIHAQKDELAARVREAQAMLAMDTDETSEKIAHAKAVAAQAQDTASR
VQSRLQDMQKNLEDWQGRFGGLRGRDLGQVVLDAGRSASTLEKTLPQLLAKLSLLENRGV
HNTSLALSASIGRVRALIAQARGAASKVKVSMKFNGRSGVQLRTPRDLSDLAAYTALKFH
LQSPTPAPAPGENTGDHFVLYMGSREASGDYLGVSLRNQKVHWVFRLGEAGPATLSIDQD
IGEQFAAISMDRTLQFGHMSITVENQVIQEIKGDTVAPGVEGLLNLRPDDFVFYVGGYPD
NFTPPPPLRFPGYRGCIEMESLNQEVLSLYNFQRTFRLNTAVDKPCARYKSTGDPWLTDG
SYFDGTGFARISFEKQFSNTKRFEQELRLVSGDGIIFFLSQFLCLAVQQGSLVLFYDFGT
GLQEAAPLHPGPPMTAASKAIQVFLLATNRKRVLVRVERLTVFSVELDNKLELADTYFLG
GVPPEQLPLSLQPLFPSGGSIRGCMKGIKALGKYVDLKRLNTTGISFGCTADLLVERIMT
FHGHGFLTLGLPSVAPLTSPVYSGFGFRSTQENGLLYHRASPDGLCQVSLKQGQVTLLLM
KTEVKTRRVFADGVPHYVAFYSNETGVWLYVDDQLQQMKPHRGPPAGLPQPAGCPLLLGG
LDEPGPLHRFSGCLSNVFVQRLQGPQRVFNLQQNLGSANVSTGCTPAPETQAAGHRRPQG
LRVSARKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVTLTQVELELE
VRPADLGQVFHGRARPPYLQLQVSKEQVLLRADDGAGEFSTWVKHPEALCDGRWHRLAAI
KSQNALCLEVDRASNHTVGPSPAALAGAPAPLHLGGLPEPTAAEGTPPAYQGCMRKLVVN
HSPIAWATATELQGEAGVSGCPVT
Download sequence
Identical sequences ENSDORP00000015608 ENSDORP00000015608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]