SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015808 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015808
Domain Number 1 Region: 143-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000067
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 2 Region: 68-183,277-284
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000314
Family Growth factor receptor domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015808   Gene: ENSDORG00000019824   Transcript: ENSDORT00000019731
Sequence length 292
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6799:11191:17262:1 gene:ENSDORG00000019824 transcript:ENSDORT00000019731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRAELCILLGGLSFFLLLMPGQGAKGGSLKERQGVCSKQTLVVPLHYNESYSQPVYKP
YLTLCAGRRICSTYRTTYRVAWREVRREVQQTHAVCCQGWKKRHPGALTCEAICLKPCLN
GGSCVGPDQCECAPGWGGKHCHVDVDECRISVTLCSHRCLNTAGSFTCSCPRGLVLGPDQ
RTCTEGSPEPPTSASILSVAIREAEHESTLRREILELRGRLEQLEQWAAQAGAWVRAVLP
MPPEELHPEQVAELWGWGDRIESLSDQVLLLEERLGACSCEDNSLGPGLNHY
Download sequence
Identical sequences ENSDORP00000015808 ENSDORP00000015808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]