SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000303 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000303
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily POZ domain 1.79e-16
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000303   Gene: ENSDORG00000000326   Transcript: ENSDORT00000000325
Sequence length 233
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4251:67577:68278:1 gene:ENSDORG00000000326 transcript:ENSDORT00000000325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGAMFRADTPVPPNVNPQAGGQYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAE
ADFYQIQPLLDALRELEASQGSPAPTAALLHADVDVSPRLVHFSARQGPHHYELSSVQVD
TFRANLFCTDAECLSALRTRFGVANGDRAEGGPHFHLEWAPRPAELPEGEYGRLGLQPLW
AGGPGDRRREVVGTPGFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH
Download sequence
Identical sequences A0A1S3EW60
ENSDORP00000000303 XP_012868653.1.60039 ENSDORP00000000303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]