SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002319 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002319
Domain Number 1 Region: 528-560,639-712
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000687
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002319   Gene: ENSDORG00000002471   Transcript: ENSDORT00000002470
Sequence length 747
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5267:6249:39871:-1 gene:ENSDORG00000002471 transcript:ENSDORT00000002470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEIPAETQRYHVERPIFSHPVLQERLHTKDKVSESIGDKLKQAFICTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXPFAVISLMIGGVAVRLVPDDIVIPGGVNTTNGTEARDALRVKVAM
SVTLLSGIIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSTVAVLQNIKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLQESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQXXXXXXXXXXXXXXXXXXXXXXXXVKEIPGIKIFQI
NAPIYYANSDLYSNALIRKTGVNPAFIMGARRKAMRKYAKEVGNANMANATVVKVTKDAE
GTKPEEDGTKPEEEDDEVKYPPIVIKNTFPEELQRFMPPRETVHTIILDFTQVNFIDSVG
VKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALQELLFYSIHDAVLGSQHR
EALEQEASASPPQEDLEPNTTPTTPEA
Download sequence
Identical sequences ENSDORP00000002319 ENSDORP00000002319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]