SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006370 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006370
Domain Number 1 Region: 133-226
Classification Level Classification E-value
Superfamily TAFH domain-like 3.01e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 414-461
Classification Level Classification E-value
Superfamily Histone-fold 3.81e-17
Family TBP-associated factors, TAFs 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006370   Gene: ENSDORG00000006800   Transcript: ENSDORT00000006799
Sequence length 572
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2656:10364:30156:-1 gene:ENSDORG00000006800 transcript:ENSDORT00000006799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQSTMAPRPATPTSAPPVQISTVQAPGTP
IIARQVTPTTIIKQVSQAQTTVQPTTTLQRSPGVQPQLVLGGSAQTASLGTATAVQTGTP
QRTVPGATTTSTAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKI
EAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPASQATTAL
TAVVLSSSVQRTAGKTAASVTSALQPPVISLTQPTQVGLVKQLVIQQPPKPGALIRPPQV
TLTQTPMVALRQPHNRIMLTTSQQIQLNQLQPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDDTFLLPAPL
QRRMLEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQAS
DVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKXXXXXXXXXXXXXXQKAKEMQQQELAQ
MRQRDANLTALAAIGPRKKRKVDCAGPGSGAE
Download sequence
Identical sequences ENSDORP00000006370 ENSDORP00000006370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]