SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007422 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007422
Domain Number 1 Region: 106-255
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.57e-45
Family Carbonic anhydrase 0.0000272
Further Details:      
 
Domain Number 2 Region: 5-63
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.0000000017
Family Carbonic anhydrase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007422   Gene: ENSDORG00000007914   Transcript: ENSDORT00000007914
Sequence length 256
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5708:30786:68691:-1 gene:ENSDORG00000007914 transcript:ENSDORT00000007914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNGGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILK
SKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHLIHWNSTLFGSID
EAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRD
YWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNF
RPTQPLSDRVIRAAFQ
Download sequence
Identical sequences ENSDORP00000007422 ENSDORP00000007422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]