SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007880 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007880
Domain Number 1 Region: 788-882
Classification Level Classification E-value
Superfamily Fibronectin type III 1.13e-17
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 2 Region: 117-219
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000901
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007880   Gene: ENSDORG00000008386   Transcript: ENSDORT00000008395
Sequence length 1025
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1902:18195:196625:-1 gene:ENSDORG00000008386 transcript:ENSDORT00000008395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGQCNMLSSLGCLLLCGSIALALGNAQKLPKGKKPNLRVHINTTSDSIFLKFLRPSPNT
KLEGFLLGYGSNLSPNQYFPLPTEGKYTEAVVDAEPKYLIVVRPAPPPSQKKSCSGKSRP
RKPLQLVVGTLTPSSVFLSWGFLINPHHDWTLPSQCPNDRLYTIRYREKDKEKKWVFQLC
PATETIVENLKPNTVYEFGVKDNMEGGIWSKIFNHKTVVGIKKVNGKIQSTYDQVHTVPA
YVPRKLIPITIIKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXKNETLALPAESKTPEVEKILTQPITVTPGTVPRSTKPTVSSAFDILETTL
XXXXXXXXXXXXXXXXXXXXXXXXXXTSDPILESVPPKTSRTLEQPRATTLAPSEVPFAS
QKVETFPSHEMKPTTPAPQQTISTPSTPKRRPRPKATRTKLTPSRTISLNVKIFLTLTMT
TTAPRQTPHVPPQPQTPQRPRFPQTQPVPKASQRATSKPKMPSSPEVSYTTPVAKDVFLP
QKPDLEVSQSEPAPLETRGIPFVPIISPSPFQEELQTTQEETDQFTQELFTTKIPRTTEL
AKTTQAPHRLYSIPGRPRIPDKPHIRPGIKQPKPSSTVRNVSIDSTHITKKPGARHPPLP
PRPTPPRRKPLPPNNVTGKPGSSGIISSSRVTSPPLRATLKPTETPSERPEIDKKQPTAP
ASGEELGNTTDFSSSPTRETDHLGKPRFKGPHVRYIPKPDNKPCSITDSIKRFPAEEATE
GNATSPPQNPPTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNKSIQL
TNQTFSTVENLKPDTSYEFQVKPKNPLGEGPASKTVAFSTESADPRVSEPISAGRDAIWT
ERPFNSDSYSECKGKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQRGHGE
DHCQFVDSFLDGRTGQQLTSDQLPTKEGYFRAVRQEPVQFGEIGGHTQINYVQWYECGTT
IPGKW
Download sequence
Identical sequences ENSDORP00000007880 ENSDORP00000007880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]