SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009595 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009595
Domain Number 1 Region: 213-341
Classification Level Classification E-value
Superfamily Kelch motif 6.54e-27
Family Kelch motif 0.013
Further Details:      
 
Domain Number 2 Region: 28-153
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 3.01e-18
Family Galactose oxidase, central domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009595   Gene: ENSDORG00000010208   Transcript: ENSDORT00000010208
Sequence length 406
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4869:2346:17871:1 gene:ENSDORG00000010208 transcript:ENSDORT00000010208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGHEDLRADDLPGPAFENYDAMELACPAERSGHVAVSDGRHMFVWGGYKSNQVRGLYD
FYLPREELWIYNMETGTWKKINTEGDVPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYM
LDSRSTDRVLQWERIDCQGVPPSSKDKLGVWVYKNXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKAPSPRAAHACATVGNKGFVFGGRYRDS
RMNDLHFLNLDTWEWNELIPQGICPIGRSWHSLTPVSSDHLFLFGGFTTDKQPLSDAWTY
CISKNEWIQFNHPYTEKPRLWHTACASDEGEVIVFGGCENNLLVHHRAAHSNEILIFSVQ
PKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS
Download sequence
Identical sequences ENSDORP00000009595 ENSDORP00000009595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]