SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009744 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009744
Domain Number 1 Region: 510-708
Classification Level Classification E-value
Superfamily Fibronectin type III 7.98e-20
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 305-490
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000119
Family Fibronectin type III 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009744   Gene: ENSDORG00000010368   Transcript: ENSDORT00000010368
Sequence length 952
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3681:536:28970:1 gene:ENSDORG00000010368 transcript:ENSDORT00000010368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLSPLTPVSPRISFKSSLQHLDLEWTVQNLPHHQELKMIFLIEISRIRTSNIIWVGNY
STTVKWNQVIHWSWKSELPLECATHFVRIKSMVDNGMPPELSSWSEWSSWEEVHAQNPLE
PNALFVFPKRKLVEEGANVTICSIFGSNLKDIFCYLEGELIHGEQLDSHILTFELSNVPF
VRVSGMNFYCVEKPTNITDGIVLFVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXHPLAPYNVSLESIEATQATLRWKVLYHGNRYSLLCQVELEGEGKVIQSNVSVKVSGE
EIFSELVPDTEYQACIRCAGAGHFWKWSEWNCQKFSTSEAAPSEALAVWSTVREENGSCI
VNLFWKPLSKLHAKGKILHYNIITENLDKPHRVKLYSASGLANDMKLTLDQCAYQINVTA
SNSAGQSPASVIAISGDSGKEEVEEERIQRTEDGFFVSWKPLSADNIIGYVVGWCVRLQD
PLCDLQWKNIGPNTTSTVISSDAFRPGIRYDFRVYGISTGRVASLIEKRTGYYRELTPSM
NPRVTVKNLTSHSFVLSWTDYSTNDQSGFIQGYHVSLKSKNRQCQPGFEKAVCSDDSVCC
KYNIKNPEQKTFTVENLQPESHYEFLVTSYTRVGEGPNGTFTAVTTPDELSYTLVQIILP
MIFSVLLIISVCYWKSQWVKEKCYPEIPDPNKSSILSLIKSKENPHLTXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXCSDYKMQIAVPACLASPLPSKESSLSSVVLLDQGEHYH
Download sequence
Identical sequences ENSDORP00000009744 ENSDORP00000009744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]