SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010581 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010581
Domain Number 1 Region: 864-970
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000109
Family cAMP-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 611-724
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000275
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010581   Gene: ENSDORG00000011259   Transcript: ENSDORT00000011261
Sequence length 1121
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3634:236757:296131:-1 gene:ENSDORG00000011259 transcript:ENSDORT00000011261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEFSQELSLNTPQNLPEIILIVSLICTVGAFVNMYLKDFPIPLPVILFLIGYSFEILSF
ASFQVQKYAIAIQWMSPELFFGLFTPVIIFTVAFDMDVYMLQKLFWQIVLITIPGFVVNY
TLILWYLQSVTKLPLKTVSWLLFAAVLVSSDPMLTAASVRDLGLSRGLTNLINGESLMTS
IISLIMYRSVVNINLKRKHMMNSTIVRDALGGIWSYFIESFLFGIINSKLMQLWMSTVFG
DDVNHISLIFSILYLVFYFCELVGMSGIFTLATMGLFLNSTSFKPGVESLLLEFWNCLSF
VAFLMVFTFIGLLIPAYTYLYISFSDIYFTLIIKLLDLELLVILLMSPFLSRLGHGFSWR
WAFIMVWSEMKGTPNINMALLLAYSDLTLGSEREKSQVLFHGVSVCLITLVVNRFILPKA
VTKLGLRDVTSTKYKSVYYTFQHFQELTKSTASTLKFDKDLANADWNMVDKAIVLQNPYA
LNQGETTEHQKVKCPHCNKEIDETLNTEAMELANRRLLSAQIASYQRQYRNETLPQNAVQ
VLVGAAGSFGEKKGEHMSPETIKTYSESRKLFAFIRKVLLNWVYNTKKEKGTPSRYISLR
LCHKIVFAEEFEYIGYLVVVMNMYPMALSWLSQLKDIYDLEIRHANYYFLAFYILESLLK
MAAIRKEYFSQAWNLFELGITLVGILDIILIETGTISYTLELVETVVFMKITRLLRILRL
LKLVTPKLLQIIDKRMSHQLSFHYAILKGYAQGEADVLNIIDQIASSKQVKQILLNRVTR
NMELARRELGYFEYDHPEITITMKTKEEINVMLNMAKEIVNVFKSKGILHKIESSEINKL
IMAKKREVLDFQSIVSSPPIDETLYHIPWLAKDDKCSQFIQEAKILTYDCGNDIFEEGDE
AEGIYIIISGMVKLKRSKPDAETDQNINSEKKDDPILYKDYVLSGEIIGELNCLINEPME
YSATCKTVVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQGI
ENFTKVMIIQTSINMKKSKLNPRKYISSQKLSLESTLINGQ
Download sequence
Identical sequences ENSDORP00000010581 ENSDORP00000010581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]