SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014827 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014827
Domain Number 1 Region: 483-511,616-691
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000769
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014827   Gene: ENSDORG00000015759   Transcript: ENSDORT00000015760
Sequence length 820
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6296:78291:96556:-1 gene:ENSDORG00000015759 transcript:ENSDORT00000015760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSAKVKTVVFGLLPILSWLPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVN
GLYSSFFPLLTYFFLGGVHQMVPGTFAVISILVGNICLQLAPESNFRVFNNATNESYIDT
AAMEAERLHVSATLACLTAVIQIGLGIVQFGFVAIYLSESFIRGFMTAAGLQILISVLKY
IFGLTVPSYTGPGSIVLTFIDICKNLPHTNIASLVFALISGIFLVLVKELNARYMHKIRF
PIPTEMIVVVVATAISGSYKMPQKYHMQIVGEIQRGFPTPVSPMVWQWKDMVGTAFSLAI
VGYVINLAMGRTLASRHGYDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGG
KSQVASLCVSLVVMVTMLVLGSYLYPLPKAVLGALIAVNLKNSLKQLADPYYLWRKSKLD
CCVWVVSFLSSFFLSLPYGVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYSR
AQEMEGIKIVTYCSPLYFANSEIFRQKVVAKTGMDPQKVLLAKQKCLRKQEKRGAIPMQR
RKSLFMKTKXXXXXXXXXXXXXXXPTDPNNNQTLNGASISHIFSPDASSATPCEPPASAE
CPREPSDPLASVPPFITFHTILDLSGVSFVLMGIKTLAKLSSTYKKIGVQVFLANIHAQV
YNDISHGGVFEDGCVERNHVFPSIHDAVLFAQANTREAAPGHSFQGAPGDTELSLYDSEE
DSPSYWDLEQEMFGSMFHAETLTALKRGPCFCGGESTPSYVPQGWTTMSKSPAHSTPPPP
TMSLVADGSLDFQMFSMSQEQKNCGDLGHYGPYAMISETQ
Download sequence
Identical sequences ENSDORP00000014827 ENSDORP00000014827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]