SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000401 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000401
Domain Number 1 Region: 815-954
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.33e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000401   Gene: ENSMICG00000000437   Transcript: ENSMICT00000000439
Sequence length 960
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_428:2166:9878:1 gene:ENSMICG00000000437 transcript:ENSMICT00000000439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSLEDLLYVPPPLKVNLVVLLAEMFMCF
EVLKPDFVQAKDLPDGHAASPRGTEASQPQNVSGSSSPVFNFRHPLLSPGGPQSPLRGST
GSLKSSPSMSHMEALGKAWNRQLPFGLDSDVDVVMGDPVLLRSVSSDSLGPPRPVPARTP
TQPPPEPGDLPTIEEALQIIHSAEPRLLPDGAADGSFYLHSPEAPSKPALASPYLPEGTS
KPLSDGPGKAPVYLPHPEGPSKPSPCPVGEASKPPVPSEGSPVATNSEVKMTSFAERKKQ
LVKAEAEAGAGSPTSTPAPPEALSSEMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLG
KSAFLQVQPREASGDADVEAEAGLAPGGERPAGEGQGEPTSRPKSVTFSPELGPVPPEGL
GEYNRAVSKLSAALSSLQRDMQRLTDQQQRLLAPPEAPGPSPPAAAVPGPTTGPKAASPS
PARRAPATRRSPPGPSPAPRSPKHARPAELLAPLTXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXERQQRRAEKPRQDKQCQEEKKDQRREEALRLAQ
EEDTVAGATRPPTAQASLEEEVGPRRGEFTRLEYERRAQLKLMDDLDKVLRPASGTGGPG
RGGRRAPRPRSGCCDDSALARSPARGLLGSRLSKIYSQSTLSLSTVANEAPNNLGVKRPT
SRAPSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSNKFIIHNAL
SHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYG
PRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKPTTPKKGGGTPK
Download sequence
Identical sequences ENSMICP00000000401 ENSMICP00000000401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]