SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000584 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000584
Domain Number 1 Region: 33-428
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.06e-69
Family L-arabinose binding protein-like 0.001
Further Details:      
 
Domain Number 2 Region: 448-562,681-821
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.65e-66
Family Phosphate binding protein-like 0.00000000107
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000000584
Domain Number - Region: 572-676
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000451
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000584   Gene: ENSMICG00000000648   Transcript: ENSMICT00000000648
Sequence length 920
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2794:265881:644095:-1 gene:ENSMICG00000000648 transcript:ENSMICT00000000648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGTLVAQPGLWTRDTSWTLLYFLCYVLPQIVPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYTAISRAILDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEATARWDGLTGRITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKI
GIWNSNSGLNMTDGNKDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGY
CLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHKADLAVAPLTITYVR
EKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIAR
FTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFF
TLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYE
KMWAFMSSRQQTALIKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKG
YGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGI
FIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLE
CGKLIREERGIRTQSSVHTV
Download sequence
Identical sequences ENSMICP00000000584 ENSMICP00000000584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]