SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000963 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000963
Domain Number 1 Region: 126-286
Classification Level Classification E-value
Superfamily Carbonic anhydrase 8.11e-46
Family Carbonic anhydrase 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000963   Gene: ENSMICG00000001059   Transcript: ENSMICT00000001058
Sequence length 288
Comment pep:known_by_projection scaffold:micMur1:scaffold_31231:5720:9334:1 gene:ENSMICG00000001059 transcript:ENSMICT00000001058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLCPSPWLPLLIPAPASGLTVQLLLSLLLLVPVHTQSTLQMQGDPPMGGGSSGEDHPL
GEEDLSSDEDPPGEDDPLGEEDPPEVEPGEDDSLKLEDLPTVEAPGDTEVPQNNAHKDKK
GDDHSHWRYGGDPPWPQVSPACAGRFQSPVDIRPELAAVCPALRPLQLLGFELPPLPKLR
LRNNGHTVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRLGSEHTVDGHRFPAEIHVVH
ISTAFAKVEDALGRPGGLAVLAAFLQEGPEENSAYEQLLSHLDEIAEE
Download sequence
Identical sequences ENSMICP00000000963 ENSMICP00000000963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]