SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001013 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001013
Domain Number 1 Region: 148-219,266-519
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.63e-92
Family NadC C-terminal domain-like 0.0000177
Further Details:      
 
Domain Number 2 Region: 15-147
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.81e-36
Family NadC N-terminal domain-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001013   Gene: ENSMICG00000001115   Transcript: ENSMICT00000001114
Sequence length 558
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4040:198155:201276:-1 gene:ENSMICG00000001115 transcript:ENSMICT00000001114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEWDSEGRAAARPLLTDLYQATMALGYWRAGRARDHAEFELFFRRCPFGGAFTLAAGL
RDCVRFLGAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSGVTVRALPEGSLAFPGVP
LLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGL
TASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPSEPILAPAAGEGSGV
DLAASVKEWLERVCAHLRLGVQEPHPGERAAFVAYALAFPRAFQGLLDSYSVWRSGLPNF
LAVALALGELGYRPVGVRLDSGDLLQLAQEVRGVFRATAAHFQVPWLESVSIAVSNNIDE
EELVRLAQEGSEVNVIGIGTSVVTCPQQPSLGCVYKLVSVGGQPRMKLTEDPEKQTLPGS
KAAFRLLGYDGSPLLDVLQFAEEPPPQAGQELRVWPRGAQEPCNVRPAQVEPLLKLWVQQ
GQLCEPLPSLAESRAFAQLSLSRLSPEHKRLRSPALYQMGPCPVLGSAPTPPILSSLQVA
LSEKLQDLVDRLRRGGPL
Download sequence
Identical sequences ENSMICP00000001013 ENSMICP00000001013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]