SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001035 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001035
Domain Number 1 Region: 108-213,251-306,350-511
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.96e-66
Family YicI catalytic domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.02e-24
Family YicI N-terminal domain-like 0.0079
Further Details:      
 
Domain Number 3 Region: 514-594
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.35e-19
Family Putative glucosidase YicI, domain 3 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001035   Gene: ENSMICG00000001135   Transcript: ENSMICT00000001137
Sequence length 646
Comment pep:novel genescaffold:micMur1:GeneScaffold_623:201644:227225:1 gene:ENSMICG00000001135 transcript:ENSMICT00000001137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFLSISTRLPSQYIYGFGETEHTAFRRNMSWNVWGMFARDEPPAYKKNSYGVHPYYMALE
EDGSAHGVLLLNSNAMDVTLQPTPALTYRTIGGILDFYVFLGPTPELVTQQYTKLIGRPA
MIPYWALGFQLSRYGYQNDTEISDLYDAMVAAQIPYDVQHVDIDYMDRKLDFTLSPSFQN
LGLLIDQMKTNGMRFILILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVWPEL
PNVIVDGSLDHETQVKLYRAYVAFPDFLRNSTAAWWKTEIQELYGNPREPEKSLKFDGLW
IDMNEPSNFVDGSVRGCSDETRNNPPYMPHLESRDKGLSSKTLCMESQQILPDGSPVRHY
DVHSLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLGKSII
GMMEFSLFGIPYTGADICGFFGDADYEMCVRWMQLGAFYPFSRNHNNVGTRRQDPVAWNS
TFEMFSRKVLRTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDITTWDIDRQFMLGPA
ILVSPVLESNTFEIRAYFPRALWYDYSMESGNKSAGEWKTLEAPLDHINLHVRGGYILPW
QEPAMNTNSSRQQFMGLIVALDDNGEAEGEIFWDDGQSIAFTIIAM
Download sequence
Identical sequences ENSMICP00000001035 ENSMICP00000001035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]