SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001089 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001089
Domain Number 1 Region: 24-285
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.02e-80
Family Carbonic anhydrase 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001089   Gene: ENSMICG00000001199   Transcript: ENSMICT00000001196
Sequence length 286
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3836:169193:236156:-1 gene:ENSMICG00000001199 transcript:ENSMICT00000001196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSFIEDSVAFEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPS
LLDIRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQ
RGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTE
ILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQ
LQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences ENSMICP00000001089 ENSMICP00000001089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]