SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001117 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001117
Domain Number 1 Region: 340-439
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.23e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 72-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.26e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 156-210,238-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001117   Gene: ENSMICG00000001229   Transcript: ENSMICT00000001227
Sequence length 616
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1891:198696:229343:1 gene:ENSMICG00000001229 transcript:ENSMICT00000001227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSSGPADLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDITKVKEQLSSSDTTPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHMVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTV
PGIPGGQAGAGKIGRMIAEEIMEIHSQLGSSPSSCGSSPLNITSTPPPDASSPGGKKILN
GGTPDIPSSGLLPGQAQENPGYPCENPHIGMDMIDNDQGSSSPSNDEAAMAVIMSLLEAD
AGLGGPVDFSDLPWPL
Download sequence
Identical sequences ENSMICP00000001117 ENSMICP00000001117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]