SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001126 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001126
Domain Number 1 Region: 147-378
Classification Level Classification E-value
Superfamily ALDH-like 8.9e-75
Family ALDH-like 0.00000000998
Further Details:      
 
Domain Number 2 Region: 5-99
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-20
Family ALDH-like 0.0000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001126   Gene: ENSMICG00000001237   Transcript: ENSMICT00000001236
Sequence length 456
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_375:1000:84288:1 gene:ENSMICG00000001237 transcript:ENSMICT00000001236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEFNAYSQEVITVLGEIDLMLENLPEWITAKPVKKNLLTMLDEAYIQPEPLGVVLIIGAW
NYPFVLTIQPLVGAIAAGNAVIIKPSELSENTAKILAKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITW
GKYMNCGQTCIAPDYILCEASLQNQIVQKIKETVKEFYGENIKESPDYERIINLRHFKRI
LGLLEGQKIAFGGETDEAMRYIAPTILTDVDPETKVMQEEIFGPVLPIVPVKSVDEAINF
INEREKPLALYIFSHNNKLIKRMIDETSSGGVTGNDVIMHFTLNSLPFGGVGSSGMGAYH
GKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKQFNKGKLGLLLLTF
LGIVAAVLVKKYQAVLRRKALLIFLVVHRLRWSSKQ
Download sequence
Identical sequences ENSMICP00000001126 ENSMICP00000001126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]