SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001206 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001206
Domain Number 1 Region: 109-357
Classification Level Classification E-value
Superfamily vWA-like 5.34e-82
Family Integrin A (or I) domain 0.0000000206
Further Details:      
 
Domain Number 2 Region: 353-443
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-30
Family Integrin domains 0.000099
Further Details:      
 
Domain Number 3 Region: 609-688
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.22e-17
Family Integrin beta tail domain 0.00048
Further Details:      
 
Domain Number 4 Region: 2-54
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000152
Family Plexin repeat 0.00084
Further Details:      
 
Domain Number 5 Region: 568-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Integrin beta EGF-like domains 0.0027
Further Details:      
 
Domain Number 6 Region: 525-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000001206
Domain Number - Region: 494-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family Integrin beta EGF-like domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001206   Gene: ENSMICG00000001321   Transcript: ENSMICT00000001321
Sequence length 775
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1261:31974:170261:-1 gene:ENSMICG00000001321 transcript:ENSMICT00000001321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNICSSGSATSCEECLLIHPKCAWCSKEXXXXXXXXTSPCDLRANLVRNGCGGEIESPAS
STRVLRSLPLSSKGSHSAGRDVIQMTPQDIAVNLRPGDKTAFQLQVRQVEDYPVDLYYLM
DLSLSMKDDLDNIRNLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIG
YKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIG
WRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGE
KLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILHGDSKNVIQLIVNAYNSIRSKVEL
SVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSVEARSCPGRHVEYTFAL
RPVGFRDSLEVGVTYNCTCGCSAGLEPNSTRCSGNGTYVCGLCECNPGHLGTRCECQEGE
NQSVYQNLCREAEGKPLCSGRGECSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCS
GHGECHCGECKCHAGYIGDNCNCSTDISTCRAKDGQICSDRGHCVCGQCQCTEPGAFGEV
CEKCPTCPDACSTKRDCVECLLLHSGKADNQTCQNLCKDEVITRVDTIVKDDQEAVLCFY
KTAKDCVMMFTYTELPSGKSNLTVLREPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXASNPLYRKPISTHTVDFTFNKFNKSYNGTVD
Download sequence
Identical sequences ENSMICP00000001206 ENSMICP00000001206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]