SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001328 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001328
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.57e-97
Family Carbonic anhydrase 0.000000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001328   Gene: ENSMICG00000001457   Transcript: ENSMICT00000001456
Sequence length 260
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4849:31060:40003:1 gene:ENSMICG00000001457 transcript:ENSMICT00000001456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEWGYADDNGPDHWHELYPYAKGDKQSPIELHTKDIQHDPSLQPWTASYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQPDGIAVVGIFLKIGREKGEFQIFLDALDKIKTKGKDAPFTHFDP
SCLFPTCRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQMAKLRSLLSSAENEPPVPL
VRNWRPPQPIKGRVVRASFK
Download sequence
Identical sequences XP_012629695.1.48125 ENSMICP00000001328 ENSMICP00000001328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]