SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001391 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001391
Domain Number 1 Region: 8-480
Classification Level Classification E-value
Superfamily ALDH-like 5.89e-115
Family ALDH-like 0.000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001391   Gene: ENSMICG00000001527   Transcript: ENSMICT00000001529
Sequence length 481
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1410:271763:295954:-1 gene:ENSMICG00000001527 transcript:ENSMICT00000001529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETKALLMLENFIDGKFLPCHSYIDSYDPSTGEVYCRVPDSGKEEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTLTLARTMDIPRSVQNFRFFASS
ILHHTSECTQMDHLGCMHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALMSHPEPLIFGSTAERITQLSAP
HRNTSPRAWGGKNPAISLDDATRLDPIPSTIRSFPTHGEICLCTSRIFVQKSIYSEFLKR
FVEATRKWKVGVPSDPSASMGALISKAHLEKVRGYVKKALSEGARIQCGEGVDKLRLPAR
NQAGYFMLPTVITDIKDESCCMKEEIFGPVTCVTPFDSEEEVIHRANDVKYGLAAAVWSR
DVGRVHRVAKKLQAGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVK
H
Download sequence
Identical sequences ENSMICP00000001391 ENSMICP00000001391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]