SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001459 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001459
Domain Number 1 Region: 137-243
Classification Level Classification E-value
Superfamily Kringle-like 1.72e-33
Family Kringle modules 0.00055
Further Details:      
 
Domain Number 2 Region: 298-359
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000000137
Family Eukaryotic proteases 0.0096
Further Details:      
 
Domain Number 3 Region: 1-31
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000806
Family Fibronectin type II module 0.018
Further Details:      
 
Domain Number 4 Region: 453-501
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000208
Family Eukaryotic proteases 0.011
Further Details:      
 
Domain Number 5 Region: 37-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000268
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000001459
Domain Number - Region: 118-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0213
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001459   Gene: ENSMICG00000001599   Transcript: ENSMICT00000001605
Sequence length 501
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4380:3154:11113:-1 gene:ENSMICG00000001599 transcript:ENSMICT00000001605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCIHKGQPGPRPWCATTPNFDQDQRWAYCLEPKNVKDHCSKHSPCQKGGTCVNTLTGPHC
LCPEHLTGRHCQREKCFEPQLLQFFHEDEMWYRVEPPGVAKCRCRGPDAHCKPVASRACR
ANPCLNRGRCLEAEGLRLCQCPEGYAGPFCDVDTEARCRDGRGLSYRGMAQTTLSGAPCQ
PWASETTYRNVTAEQALKWGLGGHPFCRNPDNDTRPWCFVWSGDRLSWEYCDLARCQPPV
QAAPPLRVPAGRQDLPSPPQPAPQKPQPTTQTQPQSQTPGPLLPKLEQRSPPAGTGPLGC
GKRLRSGLSSLTRVVGGLVALPGAQPYIAALYWGQGFCAGSFIGPCWVLAAAHCLQDRXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXHQFEGAEEYSSFLQEAQVPFISLERCSAPDVHG
AAVLPGMLCAGFLEGGTDACQ
Download sequence
Identical sequences ENSMICP00000001459 ENSMICP00000001459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]