SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001605 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001605
Domain Number 1 Region: 262-335
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.22e-21
Family Regulator of chromosome condensation RCC1 0.045
Further Details:      
 
Domain Number 2 Region: 55-113
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000000353
Family Regulator of chromosome condensation RCC1 0.052
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000001605
Domain Number - Region: 376-412
Classification Level Classification E-value
Superfamily POZ domain 0.000337
Family BTB/POZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001605   Gene: ENSMICG00000001761   Transcript: ENSMICT00000001763
Sequence length 550
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2008:305741:343010:-1 gene:ENSMICG00000001761 transcript:ENSMICT00000001763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELPLFYGESGKSVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAGNEVLY
TTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLSGKKIACLSYGSGPHIVLATTXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXVACGYAHTLVLTDEGQVYAWGANSYGQLGTGNKSNQSYP
TPVVVEKDXXXXXAACHSAHTSAKTQGGHVYMWGQCRGQSVLLPHLTHFSCTDDVFACFA
TPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLTFLVDGKYIYAHKVLLKIXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLDLATFYRENRLKKLCQQ
TIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFIS
KASRVGAFKN
Download sequence
Identical sequences ENSMICP00000001605 ENSMICP00000001605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]