SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001699 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001699
Domain Number 1 Region: 13-129
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-28
Family Kringle modules 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001699   Gene: ENSMICG00000001864   Transcript: ENSMICT00000001863
Sequence length 459
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_250:32216:35827:1 gene:ENSMICG00000001864 transcript:ENSMICT00000001863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRVLQGFLLLFPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNHTGPRGAGRPCLF
WDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMP
GYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLAR
GRLAPATDCDQICFGHPGQLCGGDGRLGIYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLQDAAEDPAPAKSAQTTAASPDESNASCSPRPGTPQA
AMGARVFSTATAVSVLLLLLLSLLRLLRRRSCLLAPGKGLPALGPSRGSRRSWAVWYRRL
RGMALLCPIWDSQAESPASSYRTLSASSQSSLRSLISAL
Download sequence
Identical sequences ENSMICP00000001699 ENSMICP00000001699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]